PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco003359.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family Whirly
Protein Properties Length: 231aa    MW: 25702.4 Da    PI: 10.3055
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco003359.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly158.12.6e-49581892139
       Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePl 99 
                  v+k+kaal++ + +p+f +l+sg+ k++++G +ll++ +a+++rkydW+kkq fals+te+++l++l++ e cef+hdp++k+s eG+v+k+l++ Pl
  Aco003359.1  58 VFKGKAALSMSPLLPKFRKLESGASKVEKNGVVLLTFWPAIGQRKYDWQKKQIFALSPTELGSLISLGPAEHCEFLHDPSMKSSLEGQVKKSLSITPL 155
                  9************************************************************************************************* PP

       Whirly 100 pdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                   + s       v n++ k+ne+fsvPv++aef+v+r++++
  Aco003359.1 156 GNDSA------VVNTVEKTNERFSVPVTRAEFTVMRTAFS 189
                  99885......56777899******************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.109.6E-6746207IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.41E-6149229IPR009044ssDNA-binding transcriptional regulator
PfamPF085363.0E-5058186IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MTKLARFLPS RNLLLRCSFN IKDAFWINSF SSHRGISSSA ADYVTDGSSG RSYANYTVFK  60
GKAALSMSPL LPKFRKLESG ASKVEKNGVV LLTFWPAIGQ RKYDWQKKQI FALSPTELGS  120
LISLGPAEHC EFLHDPSMKS SLEGQVKKSL SITPLGNDSA VVNTVEKTNE RFSVPVTRAE  180
FTVMRTAFSY VLPHLMGWDQ AVRPRQANTP ASPLKQQVEE RPNPDFEWGR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A7e-66502009165StWhy2
3n1i_A7e-66502009165protein StWhy2
3n1j_A7e-66502009165Protein StWhy2
3n1k_A7e-66502009165protein StWhy2
3n1l_A7e-66502009165protein StWhy2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008795280.11e-114PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2
SwissprotD9J0341e-71WHY2_SOLTU; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLM1H5G21e-101M1H5G2_MUSPR; Whirly transcription factor domain containing protein
STRINGGSMUA_Achr6P29060_0013e-98(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.11e-67WHIRLY 2